PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BS_3DB087DC8.2
Common NameWBLH1-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family TALE
Protein Properties Length: 765aa    MW: 80775.3 Da    PI: 6.9311
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BS_3DB087DC8.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.52.7e-095595961954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  Traes_4BS_3DB087DC8.2 559 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 596
                            554459******************************88 PP

2BELL118.72.8e-38420490272
                   BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            r e q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  Traes_4BS_3DB087DC8.2 420 RFEQQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 490
                            6799****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF504944.04E-7112199IPR009003Peptidase S1, PA clan
SMARTSM005743.2E-67344488IPR006563POX domain
PfamPF075262.1E-52349487IPR006563POX domain
PROSITE profilePS5007112.6537600IPR001356Homeobox domain
CDDcd000863.33E-13540601No hitNo description
SMARTSM003891.5E-9540604IPR001356Homeobox domain
SuperFamilySSF466892.91E-17542607IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.7E-28543606IPR009057Homeodomain-like
PfamPF059203.9E-18557596IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MGIAAPPCQA TTQHVSSTPK SSAAIYGGRP ATASSMSHSQ GFHQGSSGVY GFSSDGFDRP  60
GSSQDHDQQQ EQQHHVAQQS RRDKMRVQGF DPAAAAAHGL LPIDGDEHVE PGAMYDHAAA  120
AGASNMLAEM FNFSAQTPSG PSATELLASQ MNANYRFGFR QQAPGAVVAG LPGDGGWFGS  180
GGPGRAGVVL GGANLLGETS SPKQQGGMAG LATDPAAAMQ LFLMNPQQQQ QSRSSPTSPP  240
PSDAQSAIQH HEAFQAYGNA ASSFGGGGAG VVEGQGLSLS LSPSLQQLEM AKQAEELRVR  300
DGVLYFNRQQ QQQQQAPSVQ QLPMALHGQV GAMGQQLHVG YGPAGVAGVL RNSKYTRAAQ  360
ELLDEFCSVG RGQTIKGGGR GAGGSSSNPN ASKGGPSSSG AGQSPSSASR EPPQLSPADR  420
FEQQRKKAKL ISMLDEVDRR YNHYCDQMQM VVNFFDSVMG FGAATPYTAL AQKAMSRHFR  480
CLKDAIAAQL RHTCELLGEK DAGTSSGLTK GETPRLRAID QSLRQQRAFH HMGMMEQEAW  540
RPQRGLPERS VSILRSWLFE HFLHPYPSDA DKHLLARQTG LSRNQVSNWF INARVRLWKP  600
MIEEMYQQET KELEGSSAGG GGGGPESGND PSGADDLHSP TTTGAHQHPQ QQVVMQHGDG  660
RYGQQEHGMS GVHPHKLDPG AGPSVADAAF VGLDPAELLG GDAHVGAADD LYGRFEPGVR  720
MRYGPATTGS VSGNVSLTLG LQHAGAGNQG PDGSGRFSLR DYNGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16546603158Homeobox protein Meis1
4xrs_B1e-16546603158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5466410.0AB546641.1 Triticum aestivum WBLH1-1 mRNA for BEL1-type homeodomain protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981881.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLD4QFH90.0D4QFH9_WHEAT; BEL1-type homeodomain protein
STRINGMLOC_58467.30.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-128BEL1-like homeodomain 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]